PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_20801_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 136aa    MW: 16204.2 Da    PI: 10.8971
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_20801_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.25.2e-141153345
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    i ++s r+ ++ kRr g+lKK +EL +LC++++ +ii+s+++k
  Neem_20801_f_1 11 IVSDSARKASLKKRRVGLLKKVSELTTLCGVNAFIIIYSPEDK 53
                    568999*********************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.264153IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-18160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-22295IPR002100Transcription factor, MADS-box
CDDcd002664.22E-24285No hitNo description
PRINTSPR004047.2E-7323IPR002100Transcription factor, MADS-box
PfamPF003196.1E-141153IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MTRKKVKLVW IVSDSARKAS LKKRRVGLLK KVSELTTLCG VNAFIIIYSP EDKEPAMWPS  60
RPVVQQLLAR FHSLPEMERC KKMMNQETYL KERVTKVQEQ LKKHHRKNKE TDVSIIMRQI  120
YHDKTLDDCN KRRRKI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLVWIVSDSARKASLKKRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430045.13e-64hypothetical protein CICLE_v10013876mg
SwissprotQ9FJK31e-31AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLV4SW844e-64V4SW84_9R
STRINGPOPTR_0006s21630.17e-58(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-31AGAMOUS-like 80